CandiMentor
Quick Links
601 jobs · page 10 of 31
ahmedabad, IN
SalesGeneralsalesteam managementnetworkingcoachingnegotiationpayments

Paytm is seeking an experienced sales professional to manage the QR & Sound Box vertical. Responsibilities include growing market share, recruiting and managing a sales team, and ensuring accountability in operations. The role requires extensive travel and strong networking capabilities.

jaipur, IN
SalesGeneralsalesnegotiationcoachingmentoringpaymentsfinance

The Sales Team Lead will grow distribution and market share in the assigned area, focusing on extensive QR deployment and collateral placement. Responsibilities include recruiting and mentoring the sales team, monitoring quality parameters, and ensuring regular sales activity. Strong networking capabilities and a willingness to travel are essential.

bengaluru, IN
MarketingGeneralgrowthmarketingcampaignsanalyticsrisk managementcompliance

Paytm is seeking a Growth Manager for the Offline Payment vertical to drive acquisition and activation of Soundbox and QR merchants. The role involves planning and executing marketing campaigns, optimizing transaction growth, and collaborating with product teams to enhance user experience. The candidate will also act as a liaison between risk and compliance teams to ensure operational integrity.

noida, IN
OperationsGeneralsalesoperationsbusiness planningmarket researchproject managementfinancial analysis

Paytm is seeking an experienced Senior Manager to oversee sales operations for its merchant payment acquiring business in the UAE. Responsibilities include business planning, GTM execution, device logistics, field operations, and market research. The role requires strong analytical skills, leadership abilities, and a proven track record in managing sales teams and executing GTM programs.

chandigarh, IN
SalesITsalesedcpospayment solutionsmerchant acquisitionteam management

Paytm is seeking a State Head for its EDC/POS business to drive growth in Chandigarh. The role involves building relationships with merchants, understanding their payment needs, and providing tailored solutions. Responsibilities include team management, market expansion, client relationship management, and achieving sales targets.

hyderabad, IN
SalesGeneralsalesbusiness-developmentb2cnegotiationteam-managementpayments

Paytm is seeking an experienced sales professional to manage the QR & Sound Box vertical. The role involves growing market share, recruiting sales teams, and ensuring effective communication of plans. Candidates should have 8-12 years of experience in sales, particularly in B2C markets, and possess strong networking and negotiation skills.

Team Leader

Paytm
hyderabad, IN
SalesGeneralteam leadershipsalesmerchant engagementcommunicationcoachingperformance monitoring

The Team Leader will drive the sales of EDC machines to merchants across multiple locations. Responsibilities include creating an inspiring team environment, resolving merchant queries, and overseeing day-to-day operations. The role requires strong leadership skills and the ability to motivate and build a team.

dehradun, IN
SalesGeneralsalesnegotiationcoachingmentoringpaymentsfinance

Paytm is seeking an experienced sales professional to lead the Transit-Offline Railways vertical. Responsibilities include growing distribution, recruiting and managing a sales team, and ensuring accountability through effective communication and monitoring. The ideal candidate should possess strong networking capabilities and be willing to travel extensively.

patiala, IN
SalesGeneralsalesbusiness developmentnegotiationpaymentsfinanceteam management

Paytm is seeking an experienced sales professional to drive growth in the QR & Sound Box vertical. Responsibilities include market share growth, team recruitment, and monitoring sales quality. Ideal candidates are self-starters with strong sales and negotiation skills, preferably with experience in payments and finance.

noida, IN
MarketingGeneralcreative-designvisual-communicationad-campaignsteam-managementadobe-creative-suitefigma

As the Creative Design Lead at Paytm Ads, you will drive the visual communication strategy for in-app ad campaigns and marketing collaterals. You will manage a team of designers, oversee design execution, and collaborate with cross-functional teams to deliver impactful creatives. Proficiency in Adobe Creative Suite and Figma is required.

kanpur, IN
SalesGeneralfield salesteam managementchannel salesmerchant onboardingedc salessales tracking

We’re looking for a dynamic Team Leader to drive EDC device sales under the Oil & Gas vertical. You will manage a team of field executives, drive distribution, and ensure growth in merchant onboarding and transaction volumes. Responsibilities include leading a sales team, building channel partner relationships, and monitoring productivity.

noida, IN
OtherGeneralquality analystcall auditingbfscustomer servicems officecrm systems

We are seeking a detail-oriented Quality Analyst to join our Collections team. Responsibilities include auditing collection calls, evaluating call quality, and conducting calibration sessions. Proficiency in English and Hindi is essential.

noida, IN
OtherAuditinternal auditforensic investigationsdata analyticssqlpythonrisk advisory

We are seeking an experienced professional to join our Internal Audit team. This role involves leading risk-based internal audits, conducting forensic reviews, and leveraging data analytics to identify control gaps and fraud risks. The ideal candidate will have a strong background in internal audit and experience in fintech or large service-based organizations.

noida, IN
FinanceFinance/Bankingaccountingsapgsttdsvendor-managementaudits

The role involves managing accounts payables and receivables, overseeing accounting operations, and performing daily reconciliation of revenue and expense items. Responsibilities include vendor payment management, month-end closing activities, and ensuring compliance with tax regulations. The candidate should have experience in SAP Accounting and strong interpersonal skills.

ahmedabad, IN
SalesGeneralsalesedcpospayment solutionsmerchant acquisitionteam management

As a State Head for our EDC/POS business, you will drive growth by building relationships with merchants and providing tailored payment solutions. Responsibilities include team management, market expansion, client relationship management, and achieving sales targets. You will also collaborate with cross-functional teams to ensure seamless service delivery.

bhopal, IN
SalesGeneralb2bsalesnegotiationlead generationcold callingcommunication

The role involves increasing sales of devices among merchants in a specified area, requiring physical movement into micro markets. Responsibilities include minimizing fraud risks, adhering to risk guidelines, and engaging with various business and technology teams. Candidates should have experience in B2B field sales and possess strong communication and negotiation skills.

Premium KAM

Paytm
gurugram, IN
SalesGeneralsalespersuasionadaptabilityfocusprofessionalismurgency

The Premium KAM role at Paytm focuses on driving growth for the General Trade QR team. Responsibilities include creating funnels and closing accounts while demonstrating skills in adaptability, persuasion, and professionalism. The position requires a proactive approach to meet goals and enhance revenue through cross-selling opportunities.

noida, IN
OtherBanking/Financeproduct managementlendingfintechdata analysiscustomer experiencecredit decisioning

The role involves managing the end-to-end product lifecycle for lending journeys, including merchant onboarding and credit decisioning. You will work closely with cross-functional teams to define product requirements and optimize user funnels. A strong understanding of the lending domain and exceptional communication skills are essential.

mumbai, IN
AuditBanking/Financeinternal auditrisk managementcompliancefinancedata analyticssebi

The Manager - Internal Audit will be responsible for planning, executing, and overseeing internal audits across various functions of Paytm Money. This role involves assessing the effectiveness of internal controls, compliance, risk management practices, and adherence to regulatory standards.

bengaluru, IN
MarketingGeneralgtm strategymarketingsqlexcelproduct launchmarket research

The GTM Lead will drive the successful launch, scaling, and optimization of products and services. This role involves developing comprehensive GTM strategies, coordinating across product, marketing, sales, and customer success teams, and measuring GTM performance metrics. The ideal candidate should have 5-10 years of experience in GTM strategy and marketing.